Homo sapiens

UniProt Data

Accession Q9H305 [ UniProt ]
Name CDIP1_HUMAN
Description Cell death involved p53-target
Species Homo sapiens
Sequence Length208

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (3)

    • GO:0006915 Apoptosis
      A form of programmed cell death that begins when a cell receives internal or external signals that trigger the activity of proteolytic caspases, proceeds through a series of characteristic stages typically including rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), and plasma membrane blebbing (but maintenance of its integrity until the final stages of the process), and ends with the death of the cell.
    • GO:0033209 Tumor necrosis factor-mediated signaling pathway
      A series of molecular signals generated as a consequence of a tumor necrosis factor binding to a cell surface receptor.
    • GO:0042771 DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis
      A cascade of processes induced by the cell cycle regulator phosphoprotein p53, or an equivalent protein, in response to the detection of DNA damage and resulting in the initiation of apoptosis (programmed cell death).

    Protein Sequence

    >Q9H305
    MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHPMPQPGFIPPHMSADGTYMPP
    GFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLM
    NFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKRLC