Caenorhabditis elegans

UniProt Data

Accession Q95PX0 [ UniProt ]
Name Q95PX0_CAEEL
Description NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family
Species Caenorhabditis elegans
Sequence Length286

Enzyme Annotations (0)

    GO Annotations

    Cellular component (2)

    • GO:0005634 Nucleus
      A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    • GO:0005737 Cytoplasm
      All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >Q95PX0
    MSSKTKAVVKFTYEPRLEDELGLTKGDFVYVVEKSTDGWWKGEAPNGGVGWFPSNYVEEVEASTNGNQGSIENRNPAAAA
    VPAPIMMQAPPPKLQASRSSFEIQVVVALYSFDASSSEELSFKKGERLEIVDHPEHDPDWWMARNASGTTGLVPRNYIEV
    VVNDSSSSKASHQDFAPQYSGNGEIPMEQQPWYFGRISRERAEDLLLHGREGEFLVRDSESNPGDLSISMRGIERNKHFK
    VQNVDGLLKIGNRTFVDMNALINHYTTSPIFSSPTEKLFLTGPLPK