Mus musculus

UniProt Data

Accession P59048 [ UniProt ]
Name PDRG1_MOUSE
Description P53 and DNA damage-regulated protein 1
Species Mus musculus
Sequence Length133

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >P59048
    MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKDLSVSEDVMVCFGNMFIKMPHPKTKEMIQKD
    QEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLSPDEVKALKVILKG