Escherichia coli K-12

UniProt Data

Accession O52982 [ UniProt ]
Name YFJS_ECOLI
Description Uncharacterized lipoprotein YfjS
Species Escherichia coli K-12
Sequence Length147

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >O52982
    MKRKTLPLLALVATSLFLSACDDRSDDLKAISKFKDLTPPRFSDVVSRQDDVSEEWSQVGFSSGLTLQVLRTRESPDGCE
    GGSYYYLVDMEEKTVQPLMNALCIADNIKLEYHEVTDPYTKEKYFEYSHDGKLMGRLLIPSNPDNRE