Caenorhabditis elegans

UniProt Data

Accession O45539 [ UniProt ]
Name SRC2_CAEEL
Description Tyrosine protein-kinase src-2
Species Caenorhabditis elegans
Sequence Length507

Enzyme Annotations (1)

  • EC:2.7.10.2 Non-specific protein-tyrosine kinase.
    ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

GO Annotations

Cellular component (1)

None predicted

Molecular function (1)

None predicted

Biological process (1)

None predicted

Protein Sequence

>O45539
MGSCIGKEDPPPGATSPVHTSSTLGRESLPSHPRIPSIGPIAASSSGNTIDKNQNISQSANFVALFQYDARTDDDLSFKK
DDILEILNDTQGDWWFARHKATGRTGYIPSNYVAREKSIESQPWYFGKMRRIDAEKCLLHTLNEHGAFLVRDSESRQHDL
SLSVRENDSVKHYRIRQLDHGGYFIARRRPFATLHDLIAHYQREADGLCVNLGAPCAKSEAPQTTTFTYDDQWEVDRRSV
RLIRQIGAGQFGEVWEGRWNVNVPVAVKKLKAGTADPTDFLAEAQIMKKLRHPKLLSLYAVCTRDEPILIVTELMQENLL
TFLQRRGRQCQMPQLVEISAQVAAGMAYLEEMNFIHRDLAARNILINNSLSVKIADFGLARILMKENEYEARTGARFPIK
WTAPEAANYNRFTTKSDVWSFGILLTEIVTFGRLPYPGMTNAEVLQQVDAGYRMPCPAGCPVTLYDIMQQCWRSDPDKRP
TFETLQWKLEDLFNLDSSEYKEASINF