Mycobacterium tuberculosis H37Rv

UniProt Data

Accession I6X5B0 [ UniProt ]
Name I6X5B0_MYCTU
Description Uncharacterized protein
Species Mycobacterium tuberculosis H37Rv
Sequence Length139

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >I6X5B0
    MSAATAAWDRRAAVVVGGVAEPGSAGPIAGADRKRLISRIQVRQLDSAAVAAKRRHLYYVRPLDGHPVARVDRKTDRAAD
    SLPVAGVLGELDIPPVTVAEGLAGELASMASWLGLGGIAVSTRGDLAGELCAATKRTNG