Takifugu rubripes

UniProt Data

Accession H2ULL4 [ UniProt ]
Name H2ULL4_TAKRU
Description Uncharacterized protein
Species Takifugu rubripes
Sequence Length1471

Enzyme Annotations (0)

    GO Annotations

    Cellular component (1)

    None predicted

    Molecular function (1)

    None predicted

    Biological process (1)

    None predicted

    Protein Sequence

    >H2ULL4
    MAAEMRLPTIQKQGSMSIYGKGRKDLVVPGDIITSDTGFMRGHGTYVDEDKLTASVAGEVERVDKLICVKPLKTRFNGEV
    GDVVVGRITEVQQKRWKVETNSRLDSVLLLSAVNLPGGELRRRSAEDELTMREYLHEGDLISAEVQSVFSDGALSLHTRS
    LKYGKLGQGVLVQVSPSLIKRQKTHFHNLPCGASIILANNGFVWLYPTPEQQEEEAGGFYTSLEPVNLSDREVISRLRNC
    LMALAAHKVLLYDTSVLYCFESSLQHQVKDILKPEVMEEIVMLTQQKLLEQKVPSLLGGLLLDSERLSPAWRVPAAAWHP
    ALMGQQPGKFAGDQRRPSLPAFIKGARRESSRHATQPCNVFEVHDEGMRTSVFPSSESRVCIRPLAPEVLSDLCVYPSLP
    WSFLKLFLEALQKPDLTEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKN
    GQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYV
    SSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYNL
    TVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLVGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLYMAT
    QISSAMEYLEKKNFIHRDLAARNCLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSP
    YPGIDLSLVYELLEKDYRMDRPEGCPEKVYELMTACWRWNPAERPSFAETHQAFETMFQESSISDEVEKELGKKGKKATF
    GSIQQAPELPTKTRTLRKNMDTRDGDSPGKKIAIAIVTVSFFSSDPVEPEGAVSSPMLPRKERLLLDTNLNEDDRLLPKD
    KDKTRSGLLGLIKKKKKNAPTPPKRSSSFREMDAHHDRRGLIPDPRDGDCFNNGITLPINDLSPGLDSTKLLVTNNNGAV
    GITNGAPAFPGPLFPWKKGAPAVPGPGGKAATTPPNEEESMSNSKRFLWSSSMPVGSDGTEWKSVTLPRDLGQRHFDSGT
    FGGKPALPRKRNGEQKGEHTRRMGTLTPPPRLNTSPDLSSATLAKDTDPSPGSSPQALTPKAVRRPEVPGLDSLKTSALH
    AELLKANVFPALGAAAEESRARRQKHAADSASVRERGKLQKPKPAPPPPPTSTKTSKVSRSPTQEPPSPSPTTSDIRAKL
    PSVSEPHHTTTASDQTRSPLSEGSKKLPLGSASKPQPLKTSSSSTSVSASLSSQSLGGFSSSLTSPGDQSSPTAFIPLVN
    TRRSLRKTAPRQASERTPNSAVTRDMVLEGTELAQPFAATQSRLVATAPCWRPVRTCPTDEEQVRLPRSHQQAGEQPPGA
    ADLPHGHRANAQQDFSKLLSSVKEISDIVQR